PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100228740021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family Dof
Protein Properties Length: 239aa    MW: 26375.4 Da    PI: 8.7328
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100228740021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof72.75.1e-2329642661
                        zf-Dof 26 lsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                                  lsqPr+fCk+C+ryWt+GG+lrnvPvGgg+rknkk 
  Ote100228740021|100228740021 29 LSQPRHFCKSCKRYWTRGGTLRNVPVGGGCRKNKKF 64
                                  79********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088417.895963IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-142963IPR003851Zinc finger, Dof-type
PfamPF027013.4E-182963IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MERSTSDPLP XXXXXXXXXX XXXXXXXXLS QPRHFCKSCK RYWTRGGTLR NVPVGGGCRK  60
NKKFKRHPTS NGGGADSKTA LAKPFSLQPS IDNPSPSYNP INNTYFHSFP TELNFPFSAT  120
RVSSESPRFD DLRGPGSGFS VSPDYRNHAY EQNIGSSSFG PSPAMATLQR FAACDELSSL  180
VVGNGEIGKE TTMFEGEVCA NNQIEKIQXX XXXXXXXXVW NSNSVGVWFD PSSSVPSLI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419